SCOPe 2.07: Domain d3wmmc_: 3wmm C:

Lineage for d3wmmc_ (3wmm C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 protein domains)
   consists of four heme-binding repeats
   automatically mapped to Pfam PF02276

6. Protein automated matches [227073] (3 species)
   not a true protein

7. Species Thermochromatium tepidum [TaxId:1050] [267911] (4 PDB entries)

8. Domain d3wmmc_: 3wmm C: [265697]
   Other proteins in same PDB: d3wmm0_, d3wmm1_, d3wmm2_, d3wmm3_, d3wmm4_, d3wmm5_, d3wmm6_, d3wmm7_, d3wmm8_, d3wmm9_, d3wmma_, d3wmmb_, d3wmmd_, d3wmme_, d3wmmf_, d3wmmg_, d3wmmh1, d3wmmh2, d3wmmi_, d3wmmj_, d3wmmk_, d3wmmm_, d3wmmn_, d3wmmo_, d3wmmp_, d3wmmq_, d3wmmr_, d3wmms_, d3wmmt_, d3wmmu_, d3wmmv_, d3wmmw_, d3wmmx_, d3wmmy_, d3wmmz_
   automated match to d1eysc_
   complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, pgw, po4, uq8

Details for d3wmmc_

PDB Entry: 3wmm, 3.01 Å

PDB Description: crystal structure of the lh1-rc complex from thermochromatium tepidum in c2 form

PDB Compounds: (C:) Photosynthetic reaction center C subunit

SCOPe Domain Sequences for d3wmmc_:

Sequence; same for both SEQRES and ATOM records:

>d3wmmc_ a.138.1.2 (C:) automated matches {Thermochromatium tepidum [TaxId: 1050]}
svmllgcegpppgteqigyrgvgmenyynkrqralsiqanqpveslpaadstgpkasevy
qnvqvlkdlsvgeftrtmvavttwvspkegcnychvpgnwasddiytkvvsrrmfelvra
ansdwkahvaetgvtcytchrgnpvpkyawvtdpgpkypsglkptgqnygsktvayaslp
fdpltpfldqaneiritgnaalagsnpaslkqaewtfglmmnisdslgvgctfchntraf
ndwtqstpkrttawyairhvrdinqnyiwplndvlpasrkgpygdplrvscmtchqavnk
plygaqmakdypglykt

Timeline for d3wmmc_:

• d3wmmc_ first appeared in SCOPe 2.05
  
• d3wmmc_ appears in SCOPe 2.06