![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
![]() | Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins) consists of four heme-binding repeats automatically mapped to Pfam PF02276 |
![]() | Protein automated matches [227073] (3 species) not a true protein |
![]() | Species Thermochromatium tepidum [TaxId:1050] [267911] (5 PDB entries) |
![]() | Domain d3wmmc_: 3wmm C: [265697] Other proteins in same PDB: d3wmm0_, d3wmm1_, d3wmm2_, d3wmm3_, d3wmm4_, d3wmm5_, d3wmm6_, d3wmm7_, d3wmm8_, d3wmm9_, d3wmma_, d3wmmb_, d3wmmd_, d3wmme_, d3wmmf_, d3wmmg_, d3wmmh1, d3wmmh2, d3wmmi_, d3wmmj_, d3wmmk_, d3wmmm_, d3wmmn_, d3wmmo_, d3wmmp_, d3wmmq_, d3wmmr_, d3wmms_, d3wmmt_, d3wmmu_, d3wmmv_, d3wmmw_, d3wmmx_, d3wmmy_, d3wmmz_ automated match to d1eysc_ complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, pgw, po4, uq8 |
PDB Entry: 3wmm (more details), 3.01 Å
SCOPe Domain Sequences for d3wmmc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wmmc_ a.138.1.2 (C:) automated matches {Thermochromatium tepidum [TaxId: 1050]} svmllgcegpppgteqigyrgvgmenyynkrqralsiqanqpveslpaadstgpkasevy qnvqvlkdlsvgeftrtmvavttwvspkegcnychvpgnwasddiytkvvsrrmfelvra ansdwkahvaetgvtcytchrgnpvpkyawvtdpgpkypsglkptgqnygsktvayaslp fdpltpfldqaneiritgnaalagsnpaslkqaewtfglmmnisdslgvgctfchntraf ndwtqstpkrttawyairhvrdinqnyiwplndvlpasrkgpygdplrvscmtchqavnk plygaqmakdypglykt
Timeline for d3wmmc_:
![]() Domains from other chains: (mouse over for more information) d3wmm0_, d3wmm1_, d3wmm2_, d3wmm3_, d3wmm4_, d3wmm5_, d3wmm6_, d3wmm7_, d3wmm8_, d3wmm9_, d3wmma_, d3wmmb_, d3wmmd_, d3wmme_, d3wmmf_, d3wmmg_, d3wmmh1, d3wmmh2, d3wmmi_, d3wmmj_, d3wmmk_, d3wmmm_, d3wmmn_, d3wmmo_, d3wmmp_, d3wmmq_, d3wmmr_, d3wmms_, d3wmmt_, d3wmmu_, d3wmmv_, d3wmmw_, d3wmmx_, d3wmmy_, d3wmmz_ |