Lineage for d3wmmh2 (3wmm H:44-259)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384684Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2384685Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2384686Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 protein domains)
  6. 2384805Protein automated matches [226918] (3 species)
    not a true protein
  7. 2384819Species Thermochromatium tepidum [TaxId:1050] [267913] (4 PDB entries)
  8. 2384820Domain d3wmmh2: 3wmm H:44-259 [265701]
    Other proteins in same PDB: d3wmm0_, d3wmm1_, d3wmm2_, d3wmm3_, d3wmm4_, d3wmm5_, d3wmm6_, d3wmm7_, d3wmm8_, d3wmm9_, d3wmma_, d3wmmb_, d3wmmc_, d3wmmd_, d3wmme_, d3wmmf_, d3wmmg_, d3wmmh1, d3wmmi_, d3wmmj_, d3wmmk_, d3wmmm_, d3wmmn_, d3wmmo_, d3wmmp_, d3wmmq_, d3wmmr_, d3wmms_, d3wmmt_, d3wmmu_, d3wmmv_, d3wmmw_, d3wmmx_, d3wmmy_, d3wmmz_
    automated match to d1eysh1
    complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, pgw, po4, uq8

Details for d3wmmh2

PDB Entry: 3wmm (more details), 3.01 Å

PDB Description: crystal structure of the lh1-rc complex from thermochromatium tepidum in c2 form
PDB Compounds: (H:) Photosynthetic reaction center H subunit

SCOPe Domain Sequences for d3wmmh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wmmh2 b.41.1.1 (H:44-259) automated matches {Thermochromatium tepidum [TaxId: 1050]}
drtersggrvkvvgfpdlpdpktfvlphnggtvvaprveapvavnatpfspapgsplvpn
gdpmlsgfgpaaspdrpkhcdltfeglpkivpmrvakefsiaegdpdprgmtvvgldgev
agtvsdvwvdrsepqirylevevaankkkvllpigfsrfdkkarkvkvdaikaahfanvp
tlsnpdqvtlyeedkvcayyaggklyataeragpll

SCOPe Domain Coordinates for d3wmmh2:

Click to download the PDB-style file with coordinates for d3wmmh2.
(The format of our PDB-style files is described here.)

Timeline for d3wmmh2: