Lineage for d3umsa2 (3ums A:6-60,A:182-354)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (80 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
Protein Transducin (alpha subunit) [52623] (4 species)
common fold is interrupted with an all-alpha domain
Species Human (Homo sapiens) [TaxId:9606] [159560] (9 PDB entries) 
Domain d3umsa2: 3ums A:6-60,A:182-354 [192181]
Other proteins in same PDB: d3umsa1
complexed with cl, gdp, so4; mutant
Details for d3umsa2
PDB Entry: 3ums (more details), 2.34 Å
PDB Description: Crystal structure of the G202A mutant of human G-alpha-i1
PDB Compounds: (A:) Guanine nucleotide-binding protein G(i) subunit alpha-1SCOPe Domain Sequences for d3umsa2:
Sequence, based on SEQRES records: (download)
>d3umsa2 c.37.1.8 (A:6-60,A:182-354) Transducin (alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
saedkaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagXtgiv
ethftfkdlhfkmfdvagqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmhe
smklfdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiqc
qfedlnkrkdtkeiythftcatdtknvqfvfdavtdviiknnlkdcglf
Sequence, based on observed residues (ATOM records): (download)
>d3umsa2 c.37.1.8 (A:6-60,A:182-354) Transducin (alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
saedkaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagXtgiv
ethftfkdlhfkmfdvafegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnk
wftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtk
eiythftcatdtknvqfvfdavtdviiknnlkdcglf
SCOPe Domain Coordinates for d3umsa2:
Click to download the PDB-style file with coordinates for d3umsa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3umsa2:
- d3umsa2 first appeared in SCOPe 2.02
- d3umsa2 appears in SCOPe 2.06
- d3umsa2 appears in the current release, SCOPe 2.08
View in 3D
