Lineage for d3ucsc_ (3ucs C:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
2 helices; antiparallel hairpin, left-handed twist
Superfamily a.2.3: Chaperone J-domain [46565] (2 families) 
Family a.2.3.0: automated matches [191473] (1 protein)
not a true familyProtein automated matches [190750] (6 species)
not a true protein
Species Escherichia coli K-12 [TaxId:83333] [226715] (2 PDB entries) 
Domain d3ucsc_: 3ucs C: [217299]
automated match to d1xbla_
Details for d3ucsc_
PDB Entry: 3ucs (more details), 1.87 Å
PDB Description: crystal structure of the complex between cbpa j-domain and cbpm
PDB Compounds: (C:) Curved DNA-binding proteinSCOPe Domain Sequences for d3ucsc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ucsc_ a.2.3.0 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
gselkdyyaimgvkptddlktiktayrrlarkyhpdvskepdaearfkevaeawevlsde
qrraeydqmwqhrn
SCOPe Domain Coordinates for d3ucsc_:
Click to download the PDB-style file with coordinates for d3ucsc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ucsc_:
- d3ucsc_ first appeared in SCOPe 2.03
- d3ucsc_ appears in SCOPe 2.04
- d3ucsc_ is called d3ucsc1 in SCOPe 2.06
- d3ucsc_ appears in the current release, SCOPe 2.08, called d3ucsc1
View in 3D
