SCOPe 2.03: Domain d3ucsc_: 3ucs C:

Lineage for d3ucsc_ (3ucs C:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.3: Chaperone J-domain [46565] (2 families)

5. Family a.2.3.0: automated matches [191473] (1 protein)
   not a true family

6. Protein automated matches [190750] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [226715] (1 PDB entry)

8. Domain d3ucsc_: 3ucs C: [217299]
   automated match to d1xbla_

Details for d3ucsc_

PDB Entry: 3ucs, 1.87 Å

PDB Description: crystal structure of the complex between cbpa j-domain and cbpm

PDB Compounds: (C:) Curved DNA-binding protein

SCOPe Domain Sequences for d3ucsc_:

Sequence; same for both SEQRES and ATOM records:

>d3ucsc_ a.2.3.0 (C:) automated matches {Escherichia coli [TaxId: 83333]}
gselkdyyaimgvkptddlktiktayrrlarkyhpdvskepdaearfkevaeawevlsde
qrraeydqmwqhrn

Timeline for d3ucsc_:

• d3ucsc_ is new in SCOPe 2.03-stable
  
• d3ucsc_ appears in SCOPe 2.04
  
• d3ucsc_ appears in the current release, SCOPe 2.08, called d3ucsc1