Lineage for d3ucsc1 (3ucs C:2-73)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2689868Superfamily a.2.3: Chaperone J-domain [46565] (2 families) (S)
  5. 2689904Family a.2.3.0: automated matches [191473] (1 protein)
    not a true family
  6. 2689905Protein automated matches [190750] (8 species)
    not a true protein
  7. 2689912Species Escherichia coli K-12 [TaxId:83333] [226715] (2 PDB entries)
  8. 2689913Domain d3ucsc1: 3ucs C:2-73 [217299]
    Other proteins in same PDB: d3ucsc2
    automated match to d1xbla_

Details for d3ucsc1

PDB Entry: 3ucs (more details), 1.87 Å

PDB Description: crystal structure of the complex between cbpa j-domain and cbpm
PDB Compounds: (C:) Curved DNA-binding protein

SCOPe Domain Sequences for d3ucsc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ucsc1 a.2.3.0 (C:2-73) automated matches {Escherichia coli K-12 [TaxId: 83333]}
elkdyyaimgvkptddlktiktayrrlarkyhpdvskepdaearfkevaeawevlsdeqr
raeydqmwqhrn

SCOPe Domain Coordinates for d3ucsc1:

Click to download the PDB-style file with coordinates for d3ucsc1.
(The format of our PDB-style files is described here.)

Timeline for d3ucsc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ucsc2
View in 3D
Domains from other chains:
(mouse over for more information)
d3ucsd_