SCOPe 2.07: Domain d3ucsc1: 3ucs C:2-73

Lineage for d3ucsc1 (3ucs C:2-73)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.3: Chaperone J-domain [46565] (2 families)

5. Family a.2.3.0: automated matches [191473] (1 protein)
   not a true family

6. Protein automated matches [190750] (7 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [226715] (2 PDB entries)

8. Domain d3ucsc1: 3ucs C:2-73 [217299]
   Other proteins in same PDB: d3ucsc2
   automated match to d1xbla_

Details for d3ucsc1

PDB Entry: 3ucs, 1.87 Å

PDB Description: crystal structure of the complex between cbpa j-domain and cbpm

PDB Compounds: (C:) Curved DNA-binding protein

SCOPe Domain Sequences for d3ucsc1:

Sequence; same for both SEQRES and ATOM records:

>d3ucsc1 a.2.3.0 (C:2-73) automated matches {Escherichia coli K-12 [TaxId: 83333]}
elkdyyaimgvkptddlktiktayrrlarkyhpdvskepdaearfkevaeawevlsdeqr
raeydqmwqhrn

Timeline for d3ucsc1:

• d3ucsc1 first appeared in SCOPe 2.03, called d3ucsc_
  
• d3ucsc1 appears in SCOPe 2.06