![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.3: Chaperone J-domain [46565] (2 families) ![]() |
![]() | Family a.2.3.0: automated matches [191473] (1 protein) not a true family |
![]() | Protein automated matches [190750] (8 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [226715] (2 PDB entries) |
![]() | Domain d3ucsc1: 3ucs C:2-73 [217299] Other proteins in same PDB: d3ucsc2 automated match to d1xbla_ |
PDB Entry: 3ucs (more details), 1.87 Å
SCOPe Domain Sequences for d3ucsc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ucsc1 a.2.3.0 (C:2-73) automated matches {Escherichia coli K-12 [TaxId: 83333]} elkdyyaimgvkptddlktiktayrrlarkyhpdvskepdaearfkevaeawevlsdeqr raeydqmwqhrn
Timeline for d3ucsc1: