Lineage for d3qvna1 (3qvn A:1-89)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
2 helices; antiparallel hairpin, left-handed twistSuperfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) 
automatically mapped to Pfam PF00081
Family a.2.11.0: automated matches [227154] (1 protein)
not a true familyProtein automated matches [226859] (31 species)
not a true protein
Species Yeast (Candida albicans) [TaxId:5476] [226297] (2 PDB entries) 
Domain d3qvna1: 3qvn A:1-89 [215451]
Other proteins in same PDB: d3qvna2
automated match to d1kkca1
complexed with mn
Details for d3qvna1
PDB Entry: 3qvn (more details), 2.6 Å
PDB Description: Crystal Structure of cytosolic MnSOD3 from Candida albicans
PDB Compounds: (A:) Manganese-containing superoxide dismutaseSCOPe Domain Sequences for d3qvna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qvna1 a.2.11.0 (A:1-89) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
mitenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdl
ksvveiqqnikfhggghtnhslfwknlap
SCOPe Domain Coordinates for d3qvna1:
Click to download the PDB-style file with coordinates for d3qvna1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3qvna1:
- d3qvna1 first appeared in SCOPe 2.03
- d3qvna1 appears in SCOPe 2.04
- d3qvna1 appears in SCOPe 2.06
- d3qvna1 appears in the current release, SCOPe 2.08
View in 3D
