Lineage for d3qvna1 (3qvn A:1-89)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690619Species Yeast (Candida albicans) [TaxId:5476] [226297] (2 PDB entries)
  8. 2690636Domain d3qvna1: 3qvn A:1-89 [215451]
    Other proteins in same PDB: d3qvna2
    automated match to d1kkca1
    complexed with mn

Details for d3qvna1

PDB Entry: 3qvn (more details), 2.6 Å

PDB Description: Crystal Structure of cytosolic MnSOD3 from Candida albicans
PDB Compounds: (A:) Manganese-containing superoxide dismutase

SCOPe Domain Sequences for d3qvna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qvna1 a.2.11.0 (A:1-89) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
mitenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdl
ksvveiqqnikfhggghtnhslfwknlap

SCOPe Domain Coordinates for d3qvna1:

Click to download the PDB-style file with coordinates for d3qvna1.
(The format of our PDB-style files is described here.)

Timeline for d3qvna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qvna2