| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
| Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
| Protein automated matches [226859] (38 species) not a true protein |
| Species Yeast (Candida albicans) [TaxId:5476] [226297] (2 PDB entries) |
| Domain d3qvna1: 3qvn A:1-89 [215451] Other proteins in same PDB: d3qvna2 automated match to d1kkca1 complexed with mn |
PDB Entry: 3qvn (more details), 2.6 Å
SCOPe Domain Sequences for d3qvna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qvna1 a.2.11.0 (A:1-89) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
mitenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdl
ksvveiqqnikfhggghtnhslfwknlap
Timeline for d3qvna1: