SCOPe 2.03: Domain d3qvna1: 3qvn A:1-89

Lineage for d3qvna1 (3qvn A:1-89)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (26 species)
   not a true protein

7. Species Yeast (Candida albicans) [TaxId:5476] [226297] (2 PDB entries)

8. Domain d3qvna1: 3qvn A:1-89 [215451]
   Other proteins in same PDB: d3qvna2
   automated match to d1kkca1
   complexed with mn

Details for d3qvna1

PDB Entry: 3qvn, 2.6 Å

PDB Description: Crystal Structure of cytosolic MnSOD3 from Candida albicans

PDB Compounds: (A:) Manganese-containing superoxide dismutase

SCOPe Domain Sequences for d3qvna1:

Sequence; same for both SEQRES and ATOM records:

>d3qvna1 a.2.11.0 (A:1-89) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
mitenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdl
ksvveiqqnikfhggghtnhslfwknlap

Timeline for d3qvna1:

• d3qvna1 is new in SCOPe 2.03-stable
  
• d3qvna1 appears in SCOPe 2.04
  
• d3qvna1 appears in the current release, SCOPe 2.08