Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
Superfamily d.167.1: Peptide deformylase [56420] (2 families) nickel-dependent enzyme |
Family d.167.1.1: Peptide deformylase [56421] (2 proteins) automatically mapped to Pfam PF01327 |
Protein automated matches [190200] (10 species) not a true protein |
Species Streptococcus mutans [TaxId:210007] [255922] (1 PDB entry) |
Domain d3l87a_: 3l87 A: [247414] automated match to d2os3a_ complexed with fe |
PDB Entry: 3l87 (more details), 2 Å
SCOPe Domain Sequences for d3l87a_:
Sequence, based on SEQRES records: (download)
>d3l87a_ d.167.1.1 (A:) automated matches {Streptococcus mutans [TaxId: 210007]} msaiktitkashlidmndiireghptlravaqdvtfplneddiilgekmlqflknsqdpv taekmelrggvglaapqldiskriiavlipnpedkdgnppkeayalkevmynpriiahsv qdaaladgegclsvdrvvegyvirhsrvtieyydknsdkkklklkgyqsivvqheidhtn gimffdrineknpfeikeglllie
>d3l87a_ d.167.1.1 (A:) automated matches {Streptococcus mutans [TaxId: 210007]} msaiktitkashlidmndiireghptlravaqdvtfplneddiilgekmlqflknsqdpv taekmelrggvglaapqldiskriiavlipnpedppkeayalkevmynpriiahsvqdaa ladgegclsvdrvvegyvirhsrvtieyydknsdkkklklkgyqsivvqheidhtngimf fdrineknpfeikeglllie
Timeline for d3l87a_: