PDB entry 3l87

View 3l87 on RCSB PDB site
Description: The Crystal Structure of smu.143c from Streptococcus mutans UA159
Class: hydrolase
Keywords: def, peptide deformylase, Hydrolase, Iron, Metal-binding, Protein biosynthesis
Deposited on 2009-12-30, released 2011-01-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.219
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide deformylase
    Species: Streptococcus mutans [TaxId:210007]
    Gene: smu.143c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l87a_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l87A (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsmsaiktitkashlidmndiireghpt
    lravaqdvtfplneddiilgekmlqflknsqdpvtaekmelrggvglaapqldiskriia
    vlipnpedkdgnppkeayalkevmynpriiahsvqdaaladgegclsvdrvvegyvirhs
    rvtieyydknsdkkklklkgyqsivvqheidhtngimffdrineknpfeikeglllie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l87A (A:)
    msaiktitkashlidmndiireghptlravaqdvtfplneddiilgekmlqflknsqdpv
    taekmelrggvglaapqldiskriiavlipnpedppkeayalkevmynpriiahsvqdaa
    ladgegclsvdrvvegyvirhsrvtieyydknsdkkklklkgyqsivvqheidhtngimf
    fdrineknpfeikeglllie