Lineage for d3cxpa_ (3cxp A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969076Species Human (Homo sapiens) [TaxId:9606] [225745] (65 PDB entries)
  8. 2969115Domain d3cxpa_: 3cxp A: [231909]
    automated match to d4ag7a_
    complexed with cl; mutant

Details for d3cxpa_

PDB Entry: 3cxp (more details), 2.01 Å

PDB Description: crystal structure of human glucosamine 6-phosphate n-acetyltransferase 1 mutant e156a
PDB Compounds: (A:) Glucosamine 6-phosphate N-acetyltransferase

SCOPe Domain Sequences for d3cxpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cxpa_ d.108.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkpdetpmfdpsllkevdwsqntatfspaispthpgeglvlrplctadlnrgffkvlgql
tetgvvspeqfmksfehmkksgdyyvtvvedvtlgqivatatliiehkfihscakrgrve
dvvvsdecrgkqlgklllstltllskklncykitlaclpqnvgfykkfgytvseenymcr
rflk

SCOPe Domain Coordinates for d3cxpa_:

Click to download the PDB-style file with coordinates for d3cxpa_.
(The format of our PDB-style files is described here.)

Timeline for d3cxpa_: