PDB entry 3cxp

View 3cxp on RCSB PDB site
Description: Crystal structure of human glucosamine 6-phosphate N-acetyltransferase 1 mutant E156A
Class: transferase
Keywords: GNA1, Acyltransferase, Endosome, Golgi apparatus, Membrane, Transferase
Deposited on 2008-04-25, released 2008-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.2
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Glucosamine 6-phosphate N-acetyltransferase
  Species: Homo sapiens [TaxId:9606]
  Gene: GNPNAT1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96EK6 (0-183)
    • engineered (155)
  Domains in SCOPe 2.08: d3cxpa_
• Heterogens: CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3cxpA (A:)
  mkpdetpmfdpsllkevdwsqntatfspaispthpgeglvlrplctadlnrgffkvlgql
  tetgvvspeqfmksfehmkksgdyyvtvvedvtlgqivatatliiehkfihscakrgrve
  dvvvsdecrgkqlgklllstltllskklncykitlaclpqnvgfykkfgytvseenymcr
  rflk