Lineage for d4ag7a_ (4ag7 A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
3 layers: a/b/a; contains mixed beta-sheetSuperfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) 
Family d.108.1.0: automated matches [191308] (1 protein)
not a true familyProtein automated matches [190038] (49 species)
not a true protein
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [194915] (2 PDB entries) 
Domain d4ag7a_: 4ag7 A: [194919]
automated match to d1i21a_
complexed with coa
Details for d4ag7a_
PDB Entry: 4ag7 (more details), 1.55 Å
PDB Description: C. elegans glucosamine-6-phosphate N-acetyltransferase (GNA1): coenzyme A adduct
PDB Compounds: (A:) glucosamine-6-phosphate n-acetyltransferaseSCOPe Domain Sequences for d4ag7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ag7a_ d.108.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
mshifdasvlaphipsnlpdnfkvrplakddfskgyvdllsqltsvgnldqeafekrfea
mrtsvpnyhivviedsnsqkvvasaslvvemkfihgagsrgrvedvvvdtemrrqklgav
llktlvslgkslgvykislecvpellpfysqfgfqddcnfmtqrf
SCOPe Domain Coordinates for d4ag7a_:
Click to download the PDB-style file with coordinates for d4ag7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4ag7a_:
- d4ag7a_ first appeared in SCOPe 2.02
- d4ag7a_ appears in SCOPe 2.07
View in 3D
