| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
| Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
| Protein automated matches [190038] (49 species) not a true protein |
| Species Nematode (Caenorhabditis elegans) [TaxId:6239] [194915] (2 PDB entries) |
| Domain d4ag7a_: 4ag7 A: [194919] automated match to d1i21a_ complexed with coa |
PDB Entry: 4ag7 (more details), 1.55 Å
SCOPe Domain Sequences for d4ag7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ag7a_ d.108.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
mshifdasvlaphipsnlpdnfkvrplakddfskgyvdllsqltsvgnldqeafekrfea
mrtsvpnyhivviedsnsqkvvasaslvvemkfihgagsrgrvedvvvdtemrrqklgav
llktlvslgkslgvykislecvpellpfysqfgfqddcnfmtqrf
Timeline for d4ag7a_: