Class b: All beta proteins [48724] (178 folds) |
Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) |
Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins) automatically mapped to Pfam PF00541 |
Protein Adenovirus fiber protein "knob" domain [49837] (18 species) |
Species Human adenovirus 16 [267755] (1 PDB entry) |
Domain d3cnca_: 3cnc A: [208906] automated match to d1h7za_ |
PDB Entry: 3cnc (more details), 2.4 Å
SCOPe Domain Sequences for d3cnca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cnca_ b.21.1.1 (A:) Adenovirus fiber protein "knob" domain {Human adenovirus 16} ienntlwtgakpsancvikegedspdckltlvlvkngglingyitlmgaseytntlfknn qvtidvnlafdntgqiitylsslksnlnfkdnqnmatgtitsakgfmpsttaypfityat etlnedyiygecyykstngtlfplkvtvtlnrrmlasgmayamnfswslnaeeapettev tlitspfffsyiredd
Timeline for d3cnca_: