Lineage for d3cnca_ (3cnc A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2386499Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2386500Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2386501Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2386502Protein Adenovirus fiber protein "knob" domain [49837] (18 species)
  7. 2386505Species Human adenovirus 16 [267755] (1 PDB entry)
  8. 2386506Domain d3cnca_: 3cnc A: [208906]
    automated match to d1h7za_

Details for d3cnca_

PDB Entry: 3cnc (more details), 2.4 Å

PDB Description: Crystal Structure of Ad16 fiber knob
PDB Compounds: (A:) fiber protein

SCOPe Domain Sequences for d3cnca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cnca_ b.21.1.1 (A:) Adenovirus fiber protein "knob" domain {Human adenovirus 16}
ienntlwtgakpsancvikegedspdckltlvlvkngglingyitlmgaseytntlfknn
qvtidvnlafdntgqiitylsslksnlnfkdnqnmatgtitsakgfmpsttaypfityat
etlnedyiygecyykstngtlfplkvtvtlnrrmlasgmayamnfswslnaeeapettev
tlitspfffsyiredd

SCOPe Domain Coordinates for d3cnca_:

Click to download the PDB-style file with coordinates for d3cnca_.
(The format of our PDB-style files is described here.)

Timeline for d3cnca_: