PDB entry 3cnc

View 3cnc on RCSB PDB site
Description: Crystal Structure of Ad16 fiber knob
Class: viral protein
Keywords: adenovirus fiber knob, VIRAL PROTEIN
Deposited on 2008-03-25, released 2008-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.245
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fiber protein
    Species: Human adenovirus 16
    Gene: L5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cnca_
  • Chain 'B':
    Compound: fiber protein
    Species: Human adenovirus 16
    Gene: L5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cncb_
  • Chain 'C':
    Compound: fiber protein
    Species: Human adenovirus 16
    Gene: L5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cncc_
  • Chain 'D':
    Compound: fiber protein
    Species: Human adenovirus 16
    Gene: L5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cncd_
  • Chain 'E':
    Compound: fiber protein
    Species: Human adenovirus 16
    Gene: L5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cnce_
  • Chain 'F':
    Compound: fiber protein
    Species: Human adenovirus 16
    Gene: L5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cncf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cncA (A:)
    gshmasmtggqqmgrgsdssnaitienntlwtgakpsancvikegedspdckltlvlvkn
    gglingyitlmgaseytntlfknnqvtidvnlafdntgqiitylsslksnlnfkdnqnma
    tgtitsakgfmpsttaypfityatetlnedyiygecyykstngtlfplkvtvtlnrrmla
    sgmayamnfswslnaeeapettevtlitspfffsyiredd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cncA (A:)
    ienntlwtgakpsancvikegedspdckltlvlvkngglingyitlmgaseytntlfknn
    qvtidvnlafdntgqiitylsslksnlnfkdnqnmatgtitsakgfmpsttaypfityat
    etlnedyiygecyykstngtlfplkvtvtlnrrmlasgmayamnfswslnaeeapettev
    tlitspfffsyiredd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cncB (B:)
    gshmasmtggqqmgrgsdssnaitienntlwtgakpsancvikegedspdckltlvlvkn
    gglingyitlmgaseytntlfknnqvtidvnlafdntgqiitylsslksnlnfkdnqnma
    tgtitsakgfmpsttaypfityatetlnedyiygecyykstngtlfplkvtvtlnrrmla
    sgmayamnfswslnaeeapettevtlitspfffsyiredd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cncB (B:)
    ienntlwtgakpsancvikegedspdckltlvlvkngglingyitlmgaseytntlfknn
    qvtidvnlafdntgqiitylsslksnlnfkdnqnmatgtitsakgfmpsttaypfityat
    etlnedyiygecyykstngtlfplkvtvtlnrrmlasgmayamnfswslnaeeapettev
    tlitspfffsyiredd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3cncC (C:)
    gshmasmtggqqmgrgsdssnaitienntlwtgakpsancvikegedspdckltlvlvkn
    gglingyitlmgaseytntlfknnqvtidvnlafdntgqiitylsslksnlnfkdnqnma
    tgtitsakgfmpsttaypfityatetlnedyiygecyykstngtlfplkvtvtlnrrmla
    sgmayamnfswslnaeeapettevtlitspfffsyiredd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cncC (C:)
    ienntlwtgakpsancvikegedspdckltlvlvkngglingyitlmgaseytntlfknn
    qvtidvnlafdntgqiitylsslksnlnfkdnqnmatgtitsakgfmpsttaypfityat
    etlnedyiygecyykstngtlfplkvtvtlnrrmlasgmayamnfswslnaeeapettev
    tlitspfffsyiredd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3cncD (D:)
    gshmasmtggqqmgrgsdssnaitienntlwtgakpsancvikegedspdckltlvlvkn
    gglingyitlmgaseytntlfknnqvtidvnlafdntgqiitylsslksnlnfkdnqnma
    tgtitsakgfmpsttaypfityatetlnedyiygecyykstngtlfplkvtvtlnrrmla
    sgmayamnfswslnaeeapettevtlitspfffsyiredd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cncD (D:)
    ienntlwtgakpsancvikegedspdckltlvlvkngglingyitlmgaseytntlfknn
    qvtidvnlafdntgqiitylsslksnlnfkdnqnmatgtitsakgfmpsttaypfityat
    etlnedyiygecyykstngtlfplkvtvtlnrrmlasgmayamnfswslnaeeapettev
    tlitspfffsyiredd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3cncE (E:)
    gshmasmtggqqmgrgsdssnaitienntlwtgakpsancvikegedspdckltlvlvkn
    gglingyitlmgaseytntlfknnqvtidvnlafdntgqiitylsslksnlnfkdnqnma
    tgtitsakgfmpsttaypfityatetlnedyiygecyykstngtlfplkvtvtlnrrmla
    sgmayamnfswslnaeeapettevtlitspfffsyiredd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cncE (E:)
    ienntlwtgakpsancvikegedspdckltlvlvkngglingyitlmgaseytntlfknn
    qvtidvnlafdntgqiitylsslksnlnfkdnqnmatgtitsakgfmpsttaypfityat
    etlnedyiygecyykstngtlfplkvtvtlnrrmlasgmayamnfswslnaeeapettev
    tlitspfffsyiredd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3cncF (F:)
    gshmasmtggqqmgrgsdssnaitienntlwtgakpsancvikegedspdckltlvlvkn
    gglingyitlmgaseytntlfknnqvtidvnlafdntgqiitylsslksnlnfkdnqnma
    tgtitsakgfmpsttaypfityatetlnedyiygecyykstngtlfplkvtvtlnrrmla
    sgmayamnfswslnaeeapettevtlitspfffsyiredd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cncF (F:)
    ienntlwtgakpsancvikegedspdckltlvlvkngglingyitlmgaseytntlfknn
    qvtidvnlafdntgqiitylsslksnlnfkdnqnmatgtitsakgfmpsttaypfityat
    etlnedyiygecyykstngtlfplkvtvtlnrrmlasgmayamnfswslnaeeapettev
    tlitspfffsyiredd