Lineage for d1h7za_ (1h7z A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2386499Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2386500Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2386501Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2386502Protein Adenovirus fiber protein "knob" domain [49837] (18 species)
  7. 2386622Species Human adenovirus type 3 [TaxId:45659] [63720] (2 PDB entries)
  8. 2386623Domain d1h7za_: 1h7z A: [60733]
    complexed with so4

Details for d1h7za_

PDB Entry: 1h7z (more details), 1.6 Å

PDB Description: adenovirus ad3 fibre head
PDB Compounds: (A:) adenovirus fibre protein

SCOPe Domain Sequences for d1h7za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h7za_ b.21.1.1 (A:) Adenovirus fiber protein "knob" domain {Human adenovirus type 3 [TaxId: 45659]}
knntlwtgpkpeanciieygkqnpdskltlilvknggivngyvtlmgasdyvntlfknkn
vsinvelyfdatghilpdssslktdlelkykqtadfsargfmpsttaypfvlpnagthne
nyifgqcyykasdgalfplevtvmlnkrlpdsrtsyvmtflwslnaglapettqatlits
pftfsyiredd

SCOPe Domain Coordinates for d1h7za_:

Click to download the PDB-style file with coordinates for d1h7za_.
(The format of our PDB-style files is described here.)

Timeline for d1h7za_: