SCOPe 2.03: Domain d3cnca_: 3cnc A:

Lineage for d3cnca_ (3cnc A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
   automatically mapped to Pfam PF00541

6. Protein automated matches [190333] (6 species)
   not a true protein

7. Species Human adenovirus 16 [225470] (1 PDB entry)

8. Domain d3cnca_: 3cnc A: [208906]
   automated match to d1h7za_

Details for d3cnca_

PDB Entry: 3cnc, 2.4 Å

PDB Description: Crystal Structure of Ad16 fiber knob

PDB Compounds: (A:) fiber protein

SCOPe Domain Sequences for d3cnca_:

Sequence; same for both SEQRES and ATOM records:

>d3cnca_ b.21.1.1 (A:) automated matches {Human adenovirus 16}
ienntlwtgakpsancvikegedspdckltlvlvkngglingyitlmgaseytntlfknn
qvtidvnlafdntgqiitylsslksnlnfkdnqnmatgtitsakgfmpsttaypfityat
etlnedyiygecyykstngtlfplkvtvtlnrrmlasgmayamnfswslnaeeapettev
tlitspfffsyiredd

Timeline for d3cnca_:

• d3cnca_ is new in SCOPe 2.03-stable
  
• d3cnca_ appears in SCOPe 2.04
  
• d3cnca_ appears in the current release, SCOPe 2.08