Lineage for d3basa_ (3bas A:)
- Root: SCOPe 2.04
Class h: Coiled coil proteins [57942] (7 folds) Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
this is not a true fold; includes oligomers of shorter identical helices
Superfamily h.1.26: Myosin rod fragments [90257] (1 family) 
Family h.1.26.1: Myosin rod fragments [90258] (2 proteins) Protein Myosin S2N51 [90259] (1 species) Species Bay scallop (Argopecten irradians) [TaxId:31199] [90260] (2 PDB entries) 
Domain d3basa_: 3bas A: [155038]
automated match to d1nknb_
complexed with iod
Details for d3basa_
PDB Entry: 3bas (more details), 2.3 Å
PDB Description: crystal structure of the n-terminal region of the scallop myosin rod, monoclinic (c2) form
PDB Compounds: (A:) Myosin heavy chain, striated muscle/General control protein GCN4 chimeraSCOPe Domain Sequences for d3basa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3basa_ h.1.26.1 (A:) Myosin S2N51 {Bay scallop (Argopecten irradians) [TaxId: 31199]}
arqeeemkeqlkqmdkmkedlakterikkeleeqnvtlleqkndlfgsmkqledkveell
sknyhlenevarlkklvger
SCOPe Domain Coordinates for d3basa_:
Click to download the PDB-style file with coordinates for d3basa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3basa_:
- d3basa_ first appeared in SCOP 1.75, called d3basa1
- d3basa_ appears in SCOPe 2.03
- d3basa_ appears in SCOPe 2.05
- d3basa_ appears in the current release, SCOPe 2.08
View in 3D
