SCOP 1.75: Domain d3basa1: 3bas A:843-918

Lineage for d3basa1 (3bas A:843-918)

1. Root: SCOP 1.75

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.26: Myosin rod fragments [90257] (1 family)

5. Family h.1.26.1: Myosin rod fragments [90258] (2 proteins)

6. Protein Myosin S2N51 [90259] (1 species)

7. Species Bay scallop (Argopecten irradians) [TaxId:31199] [90260] (2 PDB entries)

8. Domain d3basa1: 3bas A:843-918 [155038]
   automatically matched to d1nknb_

Details for d3basa1

PDB Entry: 3bas, 2.3 Å

PDB Description: crystal structure of the n-terminal region of the scallop myosin rod, monoclinic (c2) form

PDB Compounds: (A:) Myosin heavy chain, striated muscle/General control protein GCN4 chimera

SCOP Domain Sequences for d3basa1:

Sequence; same for both SEQRES and ATOM records:

>d3basa1 h.1.26.1 (A:843-918) Myosin S2N51 {Bay scallop (Argopecten irradians) [TaxId: 31199]}
eeemkeqlkqmdkmkedlakterikkeleeqnvtlleqkndlfgsmkqledkveellskn
yhlenevarlkklvge

Timeline for d3basa1:

• d3basa1 is new in SCOP 1.75
  
• d3basa1 appears in SCOPe 2.01
  
• d3basa1 appears in the current release, SCOPe 2.08, called d3basa_