Lineage for d3basa1 (3bas A:843-918)

  1. Root: SCOP 1.75
  2. 894739Class h: Coiled coil proteins [57942] (7 folds)
  3. 894740Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 895719Superfamily h.1.26: Myosin rod fragments [90257] (1 family) (S)
  5. 895720Family h.1.26.1: Myosin rod fragments [90258] (2 proteins)
  6. 895728Protein Myosin S2N51 [90259] (1 species)
  7. 895729Species Bay scallop (Argopecten irradians) [TaxId:31199] [90260] (2 PDB entries)
  8. 895730Domain d3basa1: 3bas A:843-918 [155038]
    automatically matched to d1nknb_

Details for d3basa1

PDB Entry: 3bas (more details), 2.3 Å

PDB Description: crystal structure of the n-terminal region of the scallop myosin rod, monoclinic (c2) form
PDB Compounds: (A:) Myosin heavy chain, striated muscle/General control protein GCN4 chimera

SCOP Domain Sequences for d3basa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3basa1 h.1.26.1 (A:843-918) Myosin S2N51 {Bay scallop (Argopecten irradians) [TaxId: 31199]}
eeemkeqlkqmdkmkedlakterikkeleeqnvtlleqkndlfgsmkqledkveellskn
yhlenevarlkklvge

SCOP Domain Coordinates for d3basa1:

Click to download the PDB-style file with coordinates for d3basa1.
(The format of our PDB-style files is described here.)

Timeline for d3basa1: