SCOPe 2.08: Domain d3basa_: 3bas A:

Lineage for d3basa_ (3bas A:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.26: Myosin rod fragments [90257] (2 families)

5. Family h.1.26.1: Myosin rod fragments [90258] (2 proteins)

6. Protein Myosin S2N51 [90259] (1 species)

7. Species Bay scallop (Argopecten irradians) [TaxId:31199] [90260] (2 PDB entries)

8. Domain d3basa_: 3bas A: [155038]
   Other proteins in same PDB: d3basb2
   automated match to d1nknb_
   complexed with iod

Details for d3basa_

PDB Entry: 3bas, 2.3 Å

PDB Description: crystal structure of the n-terminal region of the scallop myosin rod, monoclinic (c2) form

PDB Compounds: (A:) Myosin heavy chain, striated muscle/General control protein GCN4 chimera

SCOPe Domain Sequences for d3basa_:

Sequence; same for both SEQRES and ATOM records:

>d3basa_ h.1.26.1 (A:) Myosin S2N51 {Bay scallop (Argopecten irradians) [TaxId: 31199]}
arqeeemkeqlkqmdkmkedlakterikkeleeqnvtlleqkndlfgsmkqledkveell
sknyhlenevarlkklvger

Timeline for d3basa_:

• d3basa_ first appeared in SCOP 1.75, called d3basa1
  
• d3basa_ appears in SCOPe 2.07