SCOPe 2.08: Domain d3basb1: 3bas B:835-918

Lineage for d3basb1 (3bas B:835-918)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.26: Myosin rod fragments [90257] (2 families)

5. Family h.1.26.1: Myosin rod fragments [90258] (2 proteins)

6. Protein Myosin S2N51 [90259] (1 species)

7. Species Bay scallop (Argopecten irradians) [TaxId:31199] [90260] (2 PDB entries)

8. Domain d3basb1: 3bas B:835-918 [231836]
   Other proteins in same PDB: d3basb2
   automated match to d3basa_
   complexed with iod

Details for d3basb1

PDB Entry: 3bas, 2.3 Å

PDB Description: crystal structure of the n-terminal region of the scallop myosin rod, monoclinic (c2) form

PDB Compounds: (B:) Myosin heavy chain, striated muscle/General control protein GCN4 chimera

SCOPe Domain Sequences for d3basb1:

Sequence; same for both SEQRES and ATOM records:

>d3basb1 h.1.26.1 (B:835-918) Myosin S2N51 {Bay scallop (Argopecten irradians) [TaxId: 31199]}
pllsiarqeeemkeqlkqmdkmkedlakterikkeleeqnvtlleqkndlfgsmkqledk
veellsknyhlenevarlkklvge

Timeline for d3basb1:

• d3basb1 first appeared in SCOPe 2.03, called d3basb_
  
• d3basb1 appears in SCOPe 2.07