Lineage for d3basa_ (3bas A:)

  1. Root: SCOPe 2.03
  2. 1466120Class h: Coiled coil proteins [57942] (7 folds)
  3. 1466121Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1467161Superfamily h.1.26: Myosin rod fragments [90257] (1 family) (S)
  5. 1467162Family h.1.26.1: Myosin rod fragments [90258] (2 proteins)
  6. 1467171Protein Myosin S2N51 [90259] (1 species)
  7. 1467172Species Bay scallop (Argopecten irradians) [TaxId:31199] [90260] (2 PDB entries)
  8. 1467173Domain d3basa_: 3bas A: [155038]
    automated match to d1nknb_
    complexed with iod

Details for d3basa_

PDB Entry: 3bas (more details), 2.3 Å

PDB Description: crystal structure of the n-terminal region of the scallop myosin rod, monoclinic (c2) form
PDB Compounds: (A:) Myosin heavy chain, striated muscle/General control protein GCN4 chimera

SCOPe Domain Sequences for d3basa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3basa_ h.1.26.1 (A:) Myosin S2N51 {Bay scallop (Argopecten irradians) [TaxId: 31199]}
arqeeemkeqlkqmdkmkedlakterikkeleeqnvtlleqkndlfgsmkqledkveell
sknyhlenevarlkklvger

SCOPe Domain Coordinates for d3basa_:

Click to download the PDB-style file with coordinates for d3basa_.
(The format of our PDB-style files is described here.)

Timeline for d3basa_: