Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
Protein Transcriptional regulator Cgl2612 [140181] (1 species) |
Species Corynebacterium glutamicum [TaxId:1718] [140182] (5 PDB entries) Uniprot Q8NMG3 1-174 |
Domain d2zoza1: 2zoz A:3-73 [154740] Other proteins in same PDB: d2zoza2, d2zozb2, d2zozb3 complexed with et, gol, so4 |
PDB Entry: 2zoz (more details), 1.95 Å
SCOPe Domain Sequences for d2zoza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zoza1 a.4.1.9 (A:3-73) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]} tskkemilrtaidyigeysletlsydslaeatglsksgliyhfpsrhalllgmhelladd wdkelrditrd
Timeline for d2zoza1: