Lineage for d2xbma_ (2xbm A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893582Family c.66.1.25: mRNA cap methylase [88785] (4 proteins)
  6. 2893632Protein automated matches [190302] (11 species)
    not a true protein
  7. 2893642Species Dengue virus [TaxId:12637] [189508] (1 PDB entry)
  8. 2893643Domain d2xbma_: 2xbm A: [169997]
    automated match to d1r6aa_
    complexed with gol, sah, so4

Details for d2xbma_

PDB Entry: 2xbm (more details), 2.9 Å

PDB Description: Crystal structure of the dengue virus methyltransferase bound to a 5'- capped octameric RNA
PDB Compounds: (A:) nonstructural protein ns5

SCOPe Domain Sequences for d2xbma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xbma_ c.66.1.25 (A:) automated matches {Dengue virus [TaxId: 12637]}
gsqgetlgekwkkklnqlsrkefdlykksgitevdrteakeglkrgetthhavsrgsakl
qwfvernmvipegrvidlgcgrggwsyycaglkkvtevrgytkggpgheepvpmstygwn
ivklmsgkdvfylppekcdtllcdigesspsptveesrtirvlkmvepwlknnqfcikvl
npymptviehlerlqrkhggmlvrnplsrnsthemywisngtgnivssvnmvsrlllnrf
tmthrrptiekdvdlgagtrh

SCOPe Domain Coordinates for d2xbma_:

Click to download the PDB-style file with coordinates for d2xbma_.
(The format of our PDB-style files is described here.)

Timeline for d2xbma_: