Lineage for d2uvlb_ (2uvl B:)
- Root: SCOPe 2.08
Class g: Small proteins [56992] (100 folds) 
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
metal(zinc)-bound alpha+beta foldSuperfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) 
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) 
Protein automated matches [190700] (1 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187840] (49 PDB entries) 
Domain d2uvlb_: 2uvl B: [206167]
automated match to d3mupa_
complexed with gol, zn
Details for d2uvlb_
PDB Entry: 2uvl (more details), 1.91 Å
PDB Description: human bir3 domain of baculoviral inhibitor of apoptosis repeat- containing 3 (birc3)
PDB Compounds: (B:) Baculoviral IAP repeat-containing protein 3SCOPe Domain Sequences for d2uvlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uvlb_ g.52.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smrytvsnlsmqthaarfktffnwpssvlvnpeqlasagfyyvgnsddvkcfccdgglrc
wesgddpwvqhakwfprceylirikgqefirqvqa
SCOPe Domain Coordinates for d2uvlb_:
Click to download the PDB-style file with coordinates for d2uvlb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2uvlb_:
- d2uvlb_ first appeared in SCOPe 2.03
- d2uvlb_ appears in SCOPe 2.07
View in 3D
