Lineage for d2uvla_ (2uvl A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2589070Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 2589071Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 2589072Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 2589206Protein automated matches [190700] (1 species)
    not a true protein
  7. 2589207Species Human (Homo sapiens) [TaxId:9606] [187840] (46 PDB entries)
  8. 2589214Domain d2uvla_: 2uvl A: [206166]
    automated match to d3mupa_
    complexed with gol, zn

Details for d2uvla_

PDB Entry: 2uvl (more details), 1.91 Å

PDB Description: human bir3 domain of baculoviral inhibitor of apoptosis repeat- containing 3 (birc3)
PDB Compounds: (A:) Baculoviral IAP repeat-containing protein 3

SCOPe Domain Sequences for d2uvla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uvla_ g.52.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smrytvsnlsmqthaarfktffnwpssvlvnpeqlasagfyyvgnsddvkcfccdgglrc
wesgddpwvqhakwfprceylirikgqefirqvq

SCOPe Domain Coordinates for d2uvla_:

Click to download the PDB-style file with coordinates for d2uvla_.
(The format of our PDB-style files is described here.)

Timeline for d2uvla_: