SCOPe 2.08: Domain d2uvlb_: 2uvl B:

Lineage for d2uvlb_ (2uvl B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein automated matches [190700] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187840] (49 PDB entries)

8. Domain d2uvlb_: 2uvl B: [206167]
   automated match to d3mupa_
   complexed with gol, zn

Details for d2uvlb_

PDB Entry: 2uvl, 1.91 Å

PDB Description: human bir3 domain of baculoviral inhibitor of apoptosis repeat- containing 3 (birc3)

PDB Compounds: (B:) Baculoviral IAP repeat-containing protein 3

SCOPe Domain Sequences for d2uvlb_:

Sequence; same for both SEQRES and ATOM records:

>d2uvlb_ g.52.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smrytvsnlsmqthaarfktffnwpssvlvnpeqlasagfyyvgnsddvkcfccdgglrc
wesgddpwvqhakwfprceylirikgqefirqvqa

Timeline for d2uvlb_:

• d2uvlb_ first appeared in SCOPe 2.03
  
• d2uvlb_ appears in SCOPe 2.07