PDB entry 2uvl

View 2uvl on RCSB PDB site
Description: Human BIR3 domain of Baculoviral Inhibitor of Apoptosis Repeat- Containing 3 (BIRC3)
Class: metal binding protein
Keywords: chromosomal rearrangement, metal-binding protein, polymorphism, metal-binding, focal adhesion, zinc, apoptosis, zinc-finger, zinc finger, metal binding protein
Deposited on 2007-03-12, released 2007-03-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-03-04, with a file datestamp of 2020-02-28.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Baculoviral IAP repeat-containing protein 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UVL (0-1)
    • Uniprot Q13489 (2-End)
    Domains in SCOPe 2.08: d2uvla_
  • Chain 'B':
    Compound: Baculoviral IAP repeat-containing protein 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2UVL (0-1)
    • Uniprot Q13489 (2-End)
    Domains in SCOPe 2.08: d2uvlb_
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2uvlA (A:)
smrytvsnlsmqthaarfktffnwpssvlvnpeqlasagfyyvgnsddvkcfccdgglrc
wesgddpwvqhakwfprceylirikgqefirqvqas

    Sequence, based on observed residues (ATOM records): (download) 
    >2uvlA (A:)
smrytvsnlsmqthaarfktffnwpssvlvnpeqlasagfyyvgnsddvkcfccdgglrc
wesgddpwvqhakwfprceylirikgqefirqvq

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2uvlB (B:)
smrytvsnlsmqthaarfktffnwpssvlvnpeqlasagfyyvgnsddvkcfccdgglrc
wesgddpwvqhakwfprceylirikgqefirqvqas

    Sequence, based on observed residues (ATOM records): (download) 
    >2uvlB (B:)
smrytvsnlsmqthaarfktffnwpssvlvnpeqlasagfyyvgnsddvkcfccdgglrc
wesgddpwvqhakwfprceylirikgqefirqvqa