| Class g: Small proteins [56992] (90 folds) |
| Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) ![]() |
| Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
| Protein automated matches [190700] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187840] (21 PDB entries) |
| Domain d2uvlb_: 2uvl B: [206167] automated match to d3mupa_ complexed with gol, zn |
PDB Entry: 2uvl (more details), 1.91 Å
SCOPe Domain Sequences for d2uvlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uvlb_ g.52.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smrytvsnlsmqthaarfktffnwpssvlvnpeqlasagfyyvgnsddvkcfccdgglrc
wesgddpwvqhakwfprceylirikgqefirqvqa
Timeline for d2uvlb_: