Lineage for d2qk0a_ (2qk0 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1537616Superfamily b.34.10: Cap-Gly domain [74924] (2 families) (S)
  5. 1537617Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
    Pfam PF01302
  6. 1537677Protein automated matches [226906] (1 species)
    not a true protein
  7. 1537678Species Human (Homo sapiens) [TaxId:9606] [225131] (1 PDB entry)
  8. 1537679Domain d2qk0a_: 2qk0 A: [205831]
    automated match to d2e3ia1

Details for d2qk0a_

PDB Entry: 2qk0 (more details), 2 Å

PDB Description: structural basis of microtubule plus end tracking by xmap215, clip-170 and eb1
PDB Compounds: (A:) CAP-Gly domain-containing linker protein 1

SCOPe Domain Sequences for d2qk0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qk0a_ b.34.10.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsdfrvgervwvngnkpgfiqflgetqfapgqwagivldepigkndgsvagvryfqcepl
kgiftrpskmtrk

SCOPe Domain Coordinates for d2qk0a_:

Click to download the PDB-style file with coordinates for d2qk0a_.
(The format of our PDB-style files is described here.)

Timeline for d2qk0a_: