| Class b: All beta proteins [48724] (174 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.10: Cap-Gly domain [74924] (2 families) ![]() |
| Family b.34.10.1: Cap-Gly domain [74925] (11 proteins) Pfam PF01302 |
| Protein automated matches [226906] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225131] (1 PDB entry) |
| Domain d2qk0a_: 2qk0 A: [205831] automated match to d2e3ia1 |
PDB Entry: 2qk0 (more details), 2 Å
SCOPe Domain Sequences for d2qk0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qk0a_ b.34.10.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsdfrvgervwvngnkpgfiqflgetqfapgqwagivldepigkndgsvagvryfqcepl
kgiftrpskmtrk
Timeline for d2qk0a_: