| Class b: All beta proteins [48724] (174 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.10: Cap-Gly domain [74924] (2 families) ![]() |
| Family b.34.10.1: Cap-Gly domain [74925] (11 proteins) Pfam PF01302 |
| Protein Restin [141236] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [141237] (3 PDB entries) Uniprot P30622 1-128! Uniprot P30622 181-340 |
| Domain d2e3ia1: 2e3i A:58-128 [146677] automatically matched to d2cp7a1 |
PDB Entry: 2e3i (more details), 2 Å
SCOPe Domain Sequences for d2e3ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e3ia1 b.34.10.1 (A:58-128) Restin {Human (Homo sapiens) [TaxId: 9606]}
frvgervwvngnkpgfiqflgetqfapgqwagivldepigkndgsvagvryfqceplkgi
ftrpskltrkv
Timeline for d2e3ia1: