Lineage for d2e3ia1 (2e3i A:58-128)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1311302Superfamily b.34.10: Cap-Gly domain [74924] (2 families) (S)
  5. 1311303Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
    Pfam PF01302
  6. 1311349Protein Restin [141236] (2 species)
  7. 1311350Species Human (Homo sapiens) [TaxId:9606] [141237] (3 PDB entries)
    Uniprot P30622 1-128! Uniprot P30622 181-340
  8. 1311351Domain d2e3ia1: 2e3i A:58-128 [146677]
    automatically matched to d2cp7a1

Details for d2e3ia1

PDB Entry: 2e3i (more details), 2 Å

PDB Description: Crystal structure of the CLIP-170 CAP-Gly domain 1
PDB Compounds: (A:) Restin

SCOPe Domain Sequences for d2e3ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e3ia1 b.34.10.1 (A:58-128) Restin {Human (Homo sapiens) [TaxId: 9606]}
frvgervwvngnkpgfiqflgetqfapgqwagivldepigkndgsvagvryfqceplkgi
ftrpskltrkv

SCOPe Domain Coordinates for d2e3ia1:

Click to download the PDB-style file with coordinates for d2e3ia1.
(The format of our PDB-style files is described here.)

Timeline for d2e3ia1: