Lineage for d2e3ia_ (2e3i A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2047382Superfamily b.34.10: Cap-Gly domain [74924] (2 families) (S)
  5. 2047383Family b.34.10.1: Cap-Gly domain [74925] (11 protein domains)
    Pfam PF01302
  6. 2047387Protein CLIP-115 [141230] (1 species)
  7. 2047388Species Human (Homo sapiens) [TaxId:9606] [141231] (5 PDB entries)
    Uniprot Q9UDT6 219-289! Uniprot Q9UDT6 68-149
  8. 2047390Domain d2e3ia_: 2e3i A: [146677]
    automated match to d2qk0a_

Details for d2e3ia_

PDB Entry: 2e3i (more details), 2 Å

PDB Description: Crystal structure of the CLIP-170 CAP-Gly domain 1
PDB Compounds: (A:) Restin

SCOPe Domain Sequences for d2e3ia_:

Sequence, based on SEQRES records: (download)

>d2e3ia_ b.34.10.1 (A:) CLIP-115 {Human (Homo sapiens) [TaxId: 9606]}
ddfrvgervwvngnkpgfiqflgetqfapgqwagivldepigkndgsvagvryfqceplk
giftrpskltrkvqaedeanglqttp

Sequence, based on observed residues (ATOM records): (download)

>d2e3ia_ b.34.10.1 (A:) CLIP-115 {Human (Homo sapiens) [TaxId: 9606]}
ddfrvgervwvngnkpgfiqflgetqfapgqwagivldepigkndgsvagvryfqceplk
giftrpskltrkvqattp

SCOPe Domain Coordinates for d2e3ia_:

Click to download the PDB-style file with coordinates for d2e3ia_.
(The format of our PDB-style files is described here.)

Timeline for d2e3ia_: