Lineage for d2qk0a1 (2qk0 A:30-100)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784898Superfamily b.34.10: Cap-Gly domain [74924] (2 families) (S)
  5. 2784899Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
    Pfam PF01302
  6. 2784961Protein automated matches [226906] (1 species)
    not a true protein
  7. 2784962Species Human (Homo sapiens) [TaxId:9606] [225131] (1 PDB entry)
  8. 2784963Domain d2qk0a1: 2qk0 A:30-100 [205831]
    Other proteins in same PDB: d2qk0a2
    automated match to d2e3ia1

Details for d2qk0a1

PDB Entry: 2qk0 (more details), 2 Å

PDB Description: structural basis of microtubule plus end tracking by xmap215, clip-170 and eb1
PDB Compounds: (A:) CAP-Gly domain-containing linker protein 1

SCOPe Domain Sequences for d2qk0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qk0a1 b.34.10.1 (A:30-100) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dfrvgervwvngnkpgfiqflgetqfapgqwagivldepigkndgsvagvryfqceplkg
iftrpskmtrk

SCOPe Domain Coordinates for d2qk0a1:

Click to download the PDB-style file with coordinates for d2qk0a1.
(The format of our PDB-style files is described here.)

Timeline for d2qk0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qk0a2