![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.10: Cap-Gly domain [74924] (2 families) ![]() |
![]() | Family b.34.10.1: Cap-Gly domain [74925] (11 proteins) Pfam PF01302 |
![]() | Protein automated matches [226906] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225131] (1 PDB entry) |
![]() | Domain d2qk0a1: 2qk0 A:30-100 [205831] Other proteins in same PDB: d2qk0a2 automated match to d2e3ia1 |
PDB Entry: 2qk0 (more details), 2 Å
SCOPe Domain Sequences for d2qk0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qk0a1 b.34.10.1 (A:30-100) automated matches {Human (Homo sapiens) [TaxId: 9606]} dfrvgervwvngnkpgfiqflgetqfapgqwagivldepigkndgsvagvryfqceplkg iftrpskmtrk
Timeline for d2qk0a1: