PDB entry 2qk0

View 2qk0 on RCSB PDB site
Description: Structural Basis of Microtubule Plus End Tracking by XMAP215, CLIP-170 and EB1
Class: protein binding
Keywords: CLIP-170, Cap-Gly domain, microtubule plus end, +TIP, PROTEIN BINDING
Deposited on 2007-07-09, released 2007-10-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.173
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CAP-Gly domain-containing linker protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CLIP1, CYLN1, RSN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30622 (2-End)
      • expression tag (0-1)
      • engineered (69)
    Domains in SCOPe 2.04: d2qk0a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2qk0A (A:)
gsdfrvgervwvngnkpgfiqflgetqfapgqwagivldepigkndgsvagvryfqcepl
kgiftrpskmtrkv

    Sequence, based on observed residues (ATOM records): (download) 
    >2qk0A (A:)
gsdfrvgervwvngnkpgfiqflgetqfapgqwagivldepigkndgsvagvryfqcepl
kgiftrpskmtrk