Lineage for d2pzda1 (2pzd A:359-457)
- Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds) 
Fold b.36: PDZ domain-like [50155] (1 superfamily)
contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helixSuperfamily b.36.1: PDZ domain-like [50156] (7 families) 
peptide-binding domain
Family b.36.1.4: HtrA-like serine proteases [74933] (4 proteins) Protein Mitochondrial serine protease HtrA2 [74936] (1 species) Species Human (Homo sapiens) [TaxId:9606] [74937] (2 PDB entries) 
Domain d2pzda1: 2pzd A:359-457 [149962]
automatically matched to d1lcya1
complexed with edo
Details for d2pzda1
PDB Entry: 2pzd (more details), 2.75 Å
PDB Description: crystal structure of the htra2/omi pdz domain bound to a phage-derived ligand (wtmfwv)
PDB Compounds: (A:) Serine protease HTRA2SCOPe Domain Sequences for d2pzda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pzda1 b.36.1.4 (A:359-457) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]}
rryigvmmltlspsilaelqlrepsfpdvqhgvlihkvilgspahraglrpgdvilaige
qmvqnaedvyeavrtqsqlavqirrgretltlyvtpevt
SCOPe Domain Coordinates for d2pzda1:
Click to download the PDB-style file with coordinates for d2pzda1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2pzda1:
- d2pzda1 first appeared in SCOP 1.75
- d2pzda1 appears in SCOPe 2.01
- d2pzda1 is called d2pzda_ in SCOPe 2.03
- d2pzda1 appears in the current release, SCOPe 2.08, called d2pzda_
View in 3D
