Lineage for d2pzda1 (2pzd A:359-457)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 948106Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 948107Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 948493Family b.36.1.4: HtrA-like serine proteases [74933] (4 proteins)
  6. 948494Protein Mitochondrial serine protease HtrA2 [74936] (1 species)
  7. 948495Species Human (Homo sapiens) [TaxId:9606] [74937] (2 PDB entries)
  8. 948497Domain d2pzda1: 2pzd A:359-457 [149962]
    automatically matched to d1lcya1
    complexed with edo

Details for d2pzda1

PDB Entry: 2pzd (more details), 2.75 Å

PDB Description: crystal structure of the htra2/omi pdz domain bound to a phage-derived ligand (wtmfwv)
PDB Compounds: (A:) Serine protease HTRA2

SCOPe Domain Sequences for d2pzda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pzda1 b.36.1.4 (A:359-457) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]}
rryigvmmltlspsilaelqlrepsfpdvqhgvlihkvilgspahraglrpgdvilaige
qmvqnaedvyeavrtqsqlavqirrgretltlyvtpevt

SCOPe Domain Coordinates for d2pzda1:

Click to download the PDB-style file with coordinates for d2pzda1.
(The format of our PDB-style files is described here.)

Timeline for d2pzda1: