![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
![]() | Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
![]() | Family b.36.1.0: automated matches [191362] (1 protein) not a true family |
![]() | Protein automated matches [190436] (9 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187333] (104 PDB entries) |
![]() | Domain d2pzda_: 2pzd A: [149962] automated match to d2p3wa_ complexed with edo |
PDB Entry: 2pzd (more details), 2.75 Å
SCOPe Domain Sequences for d2pzda_:
Sequence, based on SEQRES records: (download)
>d2pzda_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rryigvmmltlspsilaelqlrepsfpdvqhgvlihkvilgspahraglrpgdvilaige qmvqnaedvyeavrtqsqlavqirrgretltlyvtpevtegggwtmfwv
>d2pzda_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rryigvmmltlspsilaelqlrepsfpdvqhgvlihkvilgspahraglrpgdvilaige qmvqnaedvyeavrtqsqlavqirrgretltlyvtpevtgwtmfwv
Timeline for d2pzda_: