SCOPe 2.02: Domain d2pzdb1: 2pzd B:359-457

Lineage for d2pzdb1 (2pzd B:359-457)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.4: HtrA-like serine proteases [74933] (4 proteins)

6. Protein Mitochondrial serine protease HtrA2 [74936] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74937] (2 PDB entries)

8. Domain d2pzdb1: 2pzd B:359-457 [149963]
   automatically matched to d1lcya1
   complexed with edo

Details for d2pzdb1

PDB Entry: 2pzd, 2.75 Å

PDB Description: crystal structure of the htra2/omi pdz domain bound to a phage-derived ligand (wtmfwv)

PDB Compounds: (B:) Serine protease HTRA2

SCOPe Domain Sequences for d2pzdb1:

Sequence; same for both SEQRES and ATOM records:

>d2pzdb1 b.36.1.4 (B:359-457) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]}
rryigvmmltlspsilaelqlrepsfpdvqhgvlihkvilgspahraglrpgdvilaige
qmvqnaedvyeavrtqsqlavqirrgretltlyvtpevt

Timeline for d2pzdb1:

• d2pzdb1 first appeared in SCOP 1.75
  
• d2pzdb1 appears in SCOPe 2.01
  
• d2pzdb1 is called d2pzdb_ in SCOPe 2.03
  
• d2pzdb1 appears in the current release, SCOPe 2.08, called d2pzdb_