SCOPe 2.08: Domain d2pzdb_: 2pzd B:

Lineage for d2pzdb_ (2pzd B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (104 PDB entries)

8. Domain d2pzdb_: 2pzd B: [149963]
   automated match to d2p3wa_
   complexed with edo

Details for d2pzdb_

PDB Entry: 2pzd, 2.75 Å

PDB Description: crystal structure of the htra2/omi pdz domain bound to a phage-derived ligand (wtmfwv)

PDB Compounds: (B:) Serine protease HTRA2

SCOPe Domain Sequences for d2pzdb_:

Sequence, based on SEQRES records:

>d2pzdb_ b.36.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rryigvmmltlspsilaelqlrepsfpdvqhgvlihkvilgspahraglrpgdvilaige
qmvqnaedvyeavrtqsqlavqirrgretltlyvtpevtegggwtmfwv

Sequence, based on observed residues (ATOM records):

>d2pzdb_ b.36.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rryigvmmltlspsilaelqlrepsfpdvqhgvlihkvilgspahraglrpgdvilaige
qmvqnaedvyeavrtqsqlavqirrgretltlyvtpevtgwtmfwv

Timeline for d2pzdb_:

• d2pzdb_ first appeared in SCOP 1.75, called d2pzdb1
  
• d2pzdb_ appears in SCOPe 2.07