Lineage for d2j0oa1 (2j0o A:39-322)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.250: IpaD-like [140692] (1 superfamily)
6 helices; bundle, up-and-down; can be divided into two four-helical bundles sharing two helices (3 and 6), which are twice longer than the restSuperfamily a.250.1: IpaD-like [140693] (2 families) 
Family a.250.1.1: IpaD-like [140694] (3 proteins)
Pfam PF06511
Protein Invasin IpaD [140695] (1 species) Species Shigella flexneri [TaxId:623] [140696] (3 PDB entries)
Uniprot P18013 128-320! Uniprot P18013 144-314! Uniprot P18013 39-322
Domain d2j0oa1: 2j0o A:39-322 [137901]
Other proteins in same PDB: d2j0ob_
complexed with gol
Details for d2j0oa1
PDB Entry: 2j0o (more details), 3 Å
PDB Description: shigella flexneri ipad
PDB Compounds: (A:) invasin ipadSCOPe Domain Sequences for d2j0oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j0oa1 a.250.1.1 (A:39-322) Invasin IpaD {Shigella flexneri [TaxId: 623]}
hpvssltmlndtlhnirttnqalkkelsqktltktsleeialhssqismdvnksaqlldi
lsrheypinkdarellhsapkeaeldgdqmishrelwakiansindineqylkvyehavs
sytqmyqdfsavlsslagwispggndgnsvklqvnslkkaleelkekykdkplypanntv
sqeqankwltelggtigkvsqknggyvvsinmtpidnmlksldnlggngevvldnakyqa
wnagfsaedetmknnlqtlvqkysnansifdnlvkvlsstissc
SCOPe Domain Coordinates for d2j0oa1:
Click to download the PDB-style file with coordinates for d2j0oa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2j0oa1:
- d2j0oa1 first appeared in SCOP 1.73
- d2j0oa1 appears in SCOPe 2.06
- d2j0oa1 appears in the current release, SCOPe 2.08
View in 3D
