SCOPe 2.07: Domain d2j0ob_: 2j0o B:

Lineage for d2j0ob_ (2j0o B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.250: IpaD-like [140692] (1 superfamily)
   6 helices; bundle, up-and-down; can be divided into two four-helical bundles sharing two helices (3 and 6), which are twice longer than the rest

4. Superfamily a.250.1: IpaD-like [140693] (2 families)

5. Family a.250.1.1: IpaD-like [140694] (3 proteins)
   Pfam PF06511

6. Protein automated matches [191266] (1 species)
   not a true protein

7. Species Shigella flexneri [TaxId:623] [189835] (7 PDB entries)

8. Domain d2j0ob_: 2j0o B: [137902]
   Other proteins in same PDB: d2j0oa1
   automated match to d2j0oa1
   complexed with gol

Details for d2j0ob_

PDB Entry: 2j0o, 3 Å

PDB Description: shigella flexneri ipad

PDB Compounds: (B:) invasin ipad

SCOPe Domain Sequences for d2j0ob_:

Sequence; same for both SEQRES and ATOM records:

>d2j0ob_ a.250.1.1 (B:) automated matches {Shigella flexneri [TaxId: 623]}
hpvssltmlndtlhnirttnqalkkelsqktltktsleeialhssqismdvnksaqlldi
lsrheypinkdarellhsapkeaeldgdqmishrelwakiansindineqylkvyehavs
sytqmyqdfsavlsslagwispggndgnsvklqvnslkkaleelkekykdkplypanntv
sqeqankwltelggtigkvsqknggyvvsinmtpidnmlksldnlggngevvldnakyqa
wnagfsaedetmknnlqtlvqkysnansifdnlvkvlsstissc

Timeline for d2j0ob_:

• d2j0ob_ first appeared in SCOP 1.73, called d2j0ob1
  
• d2j0ob_ appears in SCOPe 2.06
  
• d2j0ob_ appears in the current release, SCOPe 2.08