Lineage for d2j0oa1 (2j0o A:39-322)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651720Fold a.250: IpaD-like [140692] (1 superfamily)
    6 helices; bundle, up-and-down; can be divided into two four-helical bundles sharing two helices (3 and 6), which are twice longer than the rest
  4. 651721Superfamily a.250.1: IpaD-like [140693] (1 family) (S)
  5. 651722Family a.250.1.1: IpaD-like [140694] (2 protein domains)
    Pfam PF06511
  6. 651723Protein Invasin IpaD [140695] (1 species)
  7. 651724Species Shigella flexneri [TaxId:623] [140696] (3 PDB entries)
  8. 651725Domain d2j0oa1: 2j0o A:39-322 [137901]
    complexed with gol

Details for d2j0oa1

PDB Entry: 2j0o (more details), 3 Å

PDB Description: shigella flexneri ipad
PDB Compounds: (A:) invasin ipad

SCOP Domain Sequences for d2j0oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0oa1 a.250.1.1 (A:39-322) Invasin IpaD {Shigella flexneri [TaxId: 623]}
hpvssltmlndtlhnirttnqalkkelsqktltktsleeialhssqismdvnksaqlldi
lsrheypinkdarellhsapkeaeldgdqmishrelwakiansindineqylkvyehavs
sytqmyqdfsavlsslagwispggndgnsvklqvnslkkaleelkekykdkplypanntv
sqeqankwltelggtigkvsqknggyvvsinmtpidnmlksldnlggngevvldnakyqa
wnagfsaedetmknnlqtlvqkysnansifdnlvkvlsstissc

SCOP Domain Coordinates for d2j0oa1:

Click to download the PDB-style file with coordinates for d2j0oa1.
(The format of our PDB-style files is described here.)

Timeline for d2j0oa1: