![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.250: IpaD-like [140692] (1 superfamily) 6 helices; bundle, up-and-down; can be divided into two four-helical bundles sharing two helices (3 and 6), which are twice longer than the rest |
![]() | Superfamily a.250.1: IpaD-like [140693] (2 families) ![]() |
![]() | Family a.250.1.1: IpaD-like [140694] (3 proteins) Pfam PF06511 |
![]() | Protein Invasin IpaD [140695] (1 species) |
![]() | Species Shigella flexneri [TaxId:623] [140696] (3 PDB entries) Uniprot P18013 128-320! Uniprot P18013 144-314! Uniprot P18013 39-322 |
![]() | Domain d2j0oa1: 2j0o A:39-322 [137901] Other proteins in same PDB: d2j0ob_ complexed with gol |
PDB Entry: 2j0o (more details), 3 Å
SCOPe Domain Sequences for d2j0oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j0oa1 a.250.1.1 (A:39-322) Invasin IpaD {Shigella flexneri [TaxId: 623]} hpvssltmlndtlhnirttnqalkkelsqktltktsleeialhssqismdvnksaqlldi lsrheypinkdarellhsapkeaeldgdqmishrelwakiansindineqylkvyehavs sytqmyqdfsavlsslagwispggndgnsvklqvnslkkaleelkekykdkplypanntv sqeqankwltelggtigkvsqknggyvvsinmtpidnmlksldnlggngevvldnakyqa wnagfsaedetmknnlqtlvqkysnansifdnlvkvlsstissc
Timeline for d2j0oa1: