Lineage for d2gboa1 (2gbo A:1-82)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
core: 3 helices; bundle, open
Superfamily a.23.6: EF2458-like [140404] (2 families) 
N-terminal helix swapped dimer; interrupted antiparallel coiled coilFamily a.23.6.1: EF2458-like [140405] (1 protein)
Pfam PF07408; DUF1507Protein Hypothetical protein EF2458 [140406] (1 species) Species Enterococcus faecalis [TaxId:1351] [140407] (1 PDB entry)
Uniprot Q831P3 1-82
Domain d2gboa1: 2gbo A:1-82 [134923]
Details for d2gboa1
PDB Entry: 2gbo (more details), 2.2 Å
PDB Description: Protein of Unknown Function EF2458 from Enterococcus faecalis
PDB Compounds: (A:) UPF0358 protein EF2458SCOPe Domain Sequences for d2gboa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gboa1 a.23.6.1 (A:1-82) Hypothetical protein EF2458 {Enterococcus faecalis [TaxId: 1351]}
mdegiskkfaiqlleddaerikmlirnqknslcisqckafeevvdtqmygfsrqvtyatr
lgiltndeghrllsdlerelnq
SCOPe Domain Coordinates for d2gboa1:
Click to download the PDB-style file with coordinates for d2gboa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2gboa1:
- d2gboa1 first appeared in SCOP 1.73
- d2gboa1 appears in SCOPe 2.07
View in 3D
