PDB entry 2gbo

View 2gbo on RCSB PDB site
Description: Protein of Unknown Function EF2458 from Enterococcus faecalis
Class: structural genomics, unknown function
Keywords: structural genomics, hypothetical protein, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2006-03-10, released 2006-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.199
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0358 protein EF2458
    Species: Enterococcus faecalis [TaxId:226185]
    Gene: EF_2458
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q831P3 (3-End)
      • modified residue (3)
      • modified residue (25)
      • modified residue (50)
    Domains in SCOPe 2.07: d2gboa1
  • Chain 'B':
    Compound: UPF0358 protein EF2458
    Species: Enterococcus faecalis [TaxId:226185]
    Gene: EF_2458
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q831P3 (3-End)
      • modified residue (3)
      • modified residue (25)
      • modified residue (50)
    Domains in SCOPe 2.07: d2gbob_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gboA (A:)
    snamdegiskkfaiqlleddaerikmlirnqknslcisqckafeevvdtqmygfsrqvty
    atrlgiltndeghrllsdlerelnqlytdvyeetqekneigkeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gboA (A:)
    mdegiskkfaiqlleddaerikmlirnqknslcisqckafeevvdtqmygfsrqvtyatr
    lgiltndeghrllsdlerelnq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gboB (B:)
    snamdegiskkfaiqlleddaerikmlirnqknslcisqckafeevvdtqmygfsrqvty
    atrlgiltndeghrllsdlerelnqlytdvyeetqekneigkeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gboB (B:)
    mdegiskkfaiqlleddaerikmlirnqknslcisqckafeevvdtqmygfsrqvtyatr
    lgiltndeghrllsdlerelnq