Lineage for d2gbob_ (2gbo B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699273Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 2699427Superfamily a.23.6: EF2458-like [140404] (2 families) (S)
    N-terminal helix swapped dimer; interrupted antiparallel coiled coil
  5. 2699428Family a.23.6.1: EF2458-like [140405] (1 protein)
    Pfam PF07408; DUF1507
  6. 2699429Protein Hypothetical protein EF2458 [140406] (1 species)
  7. 2699430Species Enterococcus faecalis [TaxId:1351] [140407] (1 PDB entry)
    Uniprot Q831P3 1-82
  8. 2699432Domain d2gbob_: 2gbo B: [134924]
    automated match to d2gboa1

Details for d2gbob_

PDB Entry: 2gbo (more details), 2.2 Å

PDB Description: Protein of Unknown Function EF2458 from Enterococcus faecalis
PDB Compounds: (B:) UPF0358 protein EF2458

SCOPe Domain Sequences for d2gbob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gbob_ a.23.6.1 (B:) Hypothetical protein EF2458 {Enterococcus faecalis [TaxId: 1351]}
mdegiskkfaiqlleddaerikmlirnqknslcisqckafeevvdtqmygfsrqvtyatr
lgiltndeghrllsdlerelnq

SCOPe Domain Coordinates for d2gbob_:

Click to download the PDB-style file with coordinates for d2gbob_.
(The format of our PDB-style files is described here.)

Timeline for d2gbob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2gboa1