Class a: All alpha proteins [46456] (290 folds) |
Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies) core: 3 helices; bundle, open |
Superfamily a.23.6: EF2458-like [140404] (2 families) N-terminal helix swapped dimer; interrupted antiparallel coiled coil |
Family a.23.6.1: EF2458-like [140405] (1 protein) Pfam PF07408; DUF1507 |
Protein Hypothetical protein EF2458 [140406] (1 species) |
Species Enterococcus faecalis [TaxId:1351] [140407] (1 PDB entry) Uniprot Q831P3 1-82 |
Domain d2gbob_: 2gbo B: [134924] automated match to d2gboa1 |
PDB Entry: 2gbo (more details), 2.2 Å
SCOPe Domain Sequences for d2gbob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gbob_ a.23.6.1 (B:) Hypothetical protein EF2458 {Enterococcus faecalis [TaxId: 1351]} mdegiskkfaiqlleddaerikmlirnqknslcisqckafeevvdtqmygfsrqvtyatr lgiltndeghrllsdlerelnq
Timeline for d2gbob_: