Lineage for d2gboa1 (2gbo A:1-82)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637810Fold a.23: Open three-helical up-and-down bundle [47143] (6 superfamilies)
    core: 3 helices; bundle, open
  4. 637910Superfamily a.23.6: EF2458-like [140404] (1 family) (S)
    N-terminal helix swapped dimer; interrupted antiparallel coiled coil
  5. 637911Family a.23.6.1: EF2458-like [140405] (1 protein)
    Pfam PF07408; DUF1507
  6. 637912Protein Hypothetical protein EF2458 [140406] (1 species)
  7. 637913Species Enterococcus faecalis [TaxId:1351] [140407] (1 PDB entry)
  8. 637914Domain d2gboa1: 2gbo A:1-82 [134923]

Details for d2gboa1

PDB Entry: 2gbo (more details), 2.2 Å

PDB Description: Protein of Unknown Function EF2458 from Enterococcus faecalis
PDB Compounds: (A:) UPF0358 protein EF2458

SCOP Domain Sequences for d2gboa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gboa1 a.23.6.1 (A:1-82) Hypothetical protein EF2458 {Enterococcus faecalis [TaxId: 1351]}
mdegiskkfaiqlleddaerikmlirnqknslcisqckafeevvdtqmygfsrqvtyatr
lgiltndeghrllsdlerelnq

SCOP Domain Coordinates for d2gboa1:

Click to download the PDB-style file with coordinates for d2gboa1.
(The format of our PDB-style files is described here.)

Timeline for d2gboa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2gbob1